Antibodies

View as table Download

LAYN mouse monoclonal antibody, clone AT20G8, Purified

Applications ELISA, WB
Reactivities Human

LAYN mouse monoclonal antibody, clone AT20G8, Purified

Applications ELISA, WB
Reactivities Human

Rabbit Polyclonal Anti-LAYN Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LAYN antibody: synthetic peptide directed towards the N terminal of human LAYN. Synthetic peptide located within the following region: CYKVIYFHDTSRRLNFEEAKEACRRDGGQLVSIESEDEQKLIEKFIENLL

Carrier-free (BSA/glycerol-free) LAYN mouse monoclonal antibody, clone OTI4C11 (formerly 4C11)

Applications FC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) LAYN mouse monoclonal antibody, clone OTI4D3 (formerly 4D3)

Applications WB
Reactivities Human
Conjugation Unconjugated

LAYN rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human LAYN

LAYN Rabbit polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from the Internal region of human LAYN. AA range:71-120

LAYN mouse monoclonal antibody, clone OTI4C11 (formerly 4C11), Biotinylated

Applications FC, WB
Reactivities Human
Conjugation Biotin

LAYN mouse monoclonal antibody, clone OTI4C11 (formerly 4C11), HRP conjugated

Applications FC, WB
Reactivities Human
Conjugation HRP

LAYN mouse monoclonal antibody, clone OTI4C11 (formerly 4C11)

Applications FC, WB
Reactivities Human
Conjugation Unconjugated

LAYN mouse monoclonal antibody,clone 4D3, HRP conjugated

Applications WB
Reactivities Human
Conjugation HRP

LAYN mouse monoclonal antibody, clone OTI4D3 (formerly 4D3)

Applications WB
Reactivities Human
Conjugation Unconjugated