Antibodies

Jump to Filters
View as table Download
LRRC38 (C-term) Rabbit Polyclonal Antibody
AP52534PU-N

USD 450.00

2 Weeks

LRRC38 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 195-225 amino acids from the C-terminal region of human LRRC38
LRRC38 Rabbit Polyclonal Antibody
TA337420

USD 375.00

5 Days

Rabbit Polyclonal Anti-LRRC38 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-LRRC38 antibody is: synthetic peptide directed towards the C-terminal region of Human LRRC38. Synthetic peptide located within the following region: LTDLCIIIFSGVAVSIAAIISSFFLATVVQCLQRCAPNKDAEDEDEDKDD