Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit anti-LTB4R polyclonal antibody
| Applications | WB |
| Reactivities | Bovine, Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide derived from Human BLT1 Receptor. |
Rabbit Polyclonal anti-LTB4R antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LTB4R antibody: synthetic peptide directed towards the C terminal of human LTB4R. Synthetic peptide located within the following region: AGQAAGLGLVGKRLSLARNVLIALAFLSSSVNPVLYACAGGGLLRSAGVG |
Rabbit Polyclonal Anti-LTB4R Antibody (Cytoplasmic Domain)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Leukotriene B4 Receptor / BLT1 antibody was raised against synthetic 16 amino acid peptide from 3rd cytoplasmic domain of human Leukotriene B4 Receptor. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Horse, Rabbit (100%); Bovine (88%); Opossum, Platypus (81%). |
LTB4R Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 200 to the C-terminus of human LTB4R (NP_858043.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- LTB4R