Antibodies

Jump to Filters
View as table Download
Man1c1 Rabbit Polyclonal Antibody
TA338414

USD 375.00

5 Days

Rabbit Polyclonal Anti-Man1c1 Antibody

Applications WB
Reactivities Mouse
Immunogen The immunogen for anti-Man1c1 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Man1c1. Synthetic peptide located within the following region: ESYMYLWRQTHDPIYREWGWEVVMALEKHCRTEAGFSGIQDVYSSNPNHD
MAN1C1 Rabbit Polyclonal Antibody
TA378220

USD 220.00

3 Weeks

MAN1C1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 44-240 of human MAN1C1 (NP_065112.1).
Modifications Unmodified