Antibodies

View as table Download

MOSC1 (MARC1) (Center) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen Synthetic peptide - KLH conjugated - corresponding to the central region (between 182-212aa) of human MOSC1

Rabbit Polyclonal Anti-MARC1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MOSC1 antibody: synthetic peptide directed towards the C terminal of human MOSC1. Synthetic peptide located within the following region: WDELLIGDVELKRVMACSRCILTTVDPDTGVMSRKEPLETLKSYRQCDPS

Rabbit Polyclonal Anti-MARC1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human MARC1

MARC1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human MOSC1