Rabbit Polyclonal Anti-MAST1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MAST1 antibody is: synthetic peptide directed towards the C-terminal region of Human MAST1. Synthetic peptide located within the following region: QESPLSLGADPLLPEGASRPPVSSKEKESPGGAEACTPPRATTPGGRTLE |
Rabbit Polyclonal Anti-MAST1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MAST1 antibody is: synthetic peptide directed towards the N-terminal region of Human MAST1. Synthetic peptide located within the following region: TRDPFPDVVHLEEQDSGGSNTPEQDDLSEGRSSKAKKPPGENDFDTIKLI |
Germany
Japan
United Kingdom
China