Rabbit Polyclonal Anti-MATN1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MATN1 antibody: synthetic peptide directed towards the middle region of human MATN1. Synthetic peptide located within the following region: KYLIDNSFTVSSGARPGAQKVGIVFTDGRSQDYINDAAKKAKDLGFKMFA |
MATN1 (C-term) rabbit polyclonal antibody, Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide - KLH conjugated. MATN1 / Matrilin 1 antibody was raised against a 13 amino acid peptide from near the carboxy terminus of human MATN1. |
Rabbit Polyclonal MATN1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | MATN1 antibody was raised against a 12 amino acid peptide from near the amino terminus of human MATN1. |
Germany
Japan
United Kingdom
China
