Antibodies

Jump to Filters
View as table Download
C10orf97 (FAM188A) Rabbit Polyclonal Antibody
TA343239

USD 375.00

5 Days

Rabbit Polyclonal Anti-FAM188A Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Fam188a antibody is: synthetic peptide directed towards the N-terminal region of Rat Fam188a. Synthetic peptide located within the following region: CAVIAPVQAFLLKKLLFSSEKSSWRDCSEDEQKELLCHTLCDILESACDS