Goat Anti-MOGAT2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-KESAAHILNRK, from the internal region of the protein sequence according to NP_079374.2. |
Goat Anti-MOGAT2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-KESAAHILNRK, from the internal region of the protein sequence according to NP_079374.2. |
Rabbit Polyclonal Anti-MOGAT2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MOGAT2 antibody: synthetic peptide directed towards the middle region of human MOGAT2. Synthetic peptide located within the following region: LLGIIVGGAQEALDARPGSFTLLLRNRKGFVRLALTHGAPLVPIFSFGEN |