Rabbit Polyclonal Anti-MRPS15 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MRPS15 antibody: synthetic peptide directed towards the middle region of human MRPS15. Synthetic peptide located within the following region: QFMKKIVANPEDTRSLEARIIALSVKIRSYEEHLEKHRKDKAHKRYLLMS |
Rabbit Polyclonal Anti-MRPS15 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MRPS15 antibody: synthetic peptide directed towards the N terminal of human MRPS15. Synthetic peptide located within the following region: FNQWGLQPRSLLLQAARGYVVRKPAQSRLDDDPPPSTLLKDYQNVPGIEK |
Rabbit Polyclonal Anti-MRPS15 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MRPS15 antibody: synthetic peptide directed towards the C terminal of human MRPS15. Synthetic peptide located within the following region: RRFVTKKALCIRVFQETQKLKKRRRALKAAAAAQKQAKRRNPDSPAKAIP |
Rabbit Polyclonal Anti-MRPS15 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-MRPS15 Antibody: synthetic peptide directed towards the N terminal of human MRPS15. Synthetic peptide located within the following region: RGYVVRKPAQSRLDDDPPPSTLLKDYQNVPGIEKVDDVVKRLLSLEMANK |
MRPS15 (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | Synthetic peptide - KLH conjugated - corresponding to the central region (between 123-153aa) of human MRPS15. |
Carrier-free (BSA/glycerol-free) MRPS15 mouse monoclonal antibody, clone OTI6D2 (formerly 6D2)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MRPS15 mouse monoclonal antibody, clone OTI5F5 (formerly 5F5)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
MRPS15 mouse monoclonal antibody, clone OTI6D2 (formerly 6D2)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
MRPS15 mouse monoclonal antibody, clone OTI6D2 (formerly 6D2), Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
MRPS15 mouse monoclonal antibody, clone OTI6D2 (formerly 6D2), HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
MRPS15 mouse monoclonal antibody, clone OTI6D2 (formerly 6D2)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
MRPS15 mouse monoclonal antibody, clone OTI5F5 (formerly 5F5)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
MRPS15 mouse monoclonal antibody, clone OTI5F5 (formerly 5F5), Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
MRPS15 mouse monoclonal antibody, clone OTI5F5 (formerly 5F5), HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
MRPS15 mouse monoclonal antibody, clone OTI5F5 (formerly 5F5)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China
