Rabbit Polyclonal Anti-MAGEA6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MAGEA6 antibody: synthetic peptide directed towards the middle region of human MAGEA6. Synthetic peptide located within the following region: APEEKIWEELSVLEVFEGREDSIFGDPKKLLTQYFVQENYLEYRQVPGSD |
Rabbit Polyclonal Anti-MAGEA6 Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human MAGEA6 |
MAGEA6 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human MAGEA6 |
Germany
Japan
United Kingdom
China