Antibodies

Jump to Filters
View as table Download
MOSC2 (MARC2) Rabbit Polyclonal Antibody
TA330662

USD 375.00

5 Days

Rabbit Polyclonal Anti-MARC2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-MARC2 antibody is: synthetic peptide directed towards the C-terminal region of Human MARC2. Synthetic peptide located within the following region: ACPRCILTTVDPDTGVIDRKQPLDTLKSYRLCDPSERELYKLSPLFGIYY
MOSC2 (MARC2) (C-term) Rabbit Polyclonal Antibody
AP18118PU-N

USD 450.00

2 Weeks

MOSC2 (MARC2) (C-term) rabbit polyclonal antibody

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide selected from the C-terminal region of human MOSC2