Antibodies

View as table Download

Rabbit polyclonal anti-MARCH2 antibody

Applications IF, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human MARCH2.

Rabbit Polyclonal Anti-MARCH2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MARCH2 antibody: synthetic peptide directed towards the C terminal of human MARCH2. Synthetic peptide located within the following region: TIALFTIYVLWTLVSFRYHCQLYSEWRKTNQKVRLKIREADSPEGPQHSP

MARCH2 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Human MARCH2

MARCH2 Antibody - middle region

Applications WB
Reactivities Mouse
Conjugation Unconjugated