MARK3 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human MARK3 |
MARK3 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human MARK3 |
Rabbit polyclonal anti-MARK3 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human MARK3. |
Rabbit Polyclonal Anti-MARK3 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MARK3 antibody: synthetic peptide directed towards the middle region of human MARK3. Synthetic peptide located within the following region: ATYNGPPASPSLSHEATPLSQTRSRGSTNLFSKLTSKLTRSRNVSAEQKD |
Carrier-free (BSA/glycerol-free) MARK3 mouse monoclonal antibody, clone OTI2A4 (formerly 2A4)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MARK3 mouse monoclonal antibody, clone OTI2G8 (formerly 2G8)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MARK3 mouse monoclonal antibody, clone OTI2D3 (formerly 2D3)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MARK3 mouse monoclonal antibody, clone OTI2D9 (formerly 2D9)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MARK3 mouse monoclonal antibody, clone OTI3F6 (formerly 3F6)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MARK3 mouse monoclonal antibody, clone OTI3E11 (formerly 3E11)
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MARK3 mouse monoclonal antibody, clone OTI3D8 (formerly 3D8)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MARK3 mouse monoclonal antibody, clone OTI4A3 (formerly 4A3)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MARK3 mouse monoclonal antibody, clone OTI5E5 (formerly 5E5)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
MARK3 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human MARK3 |
MARK3 Rabbit polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human MARK3. |
Modifications | Unmodified |
MARK3 mouse monoclonal antibody, clone OTI2A4 (formerly 2A4)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
MARK3 mouse monoclonal antibody, clone OTI2A4 (formerly 2A4), Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
MARK3 mouse monoclonal antibody, clone OTI2A4 (formerly 2A4), HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
MARK3 mouse monoclonal antibody, clone OTI2A4 (formerly 2A4)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
MARK3 mouse monoclonal antibody, clone OTI2G8 (formerly 2G8)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
MARK3 mouse monoclonal antibody, clone OTI2G8 (formerly 2G8), Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
MARK3 mouse monoclonal antibody, clone OTI2G8 (formerly 2G8), HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
MARK3 mouse monoclonal antibody, clone OTI2G8 (formerly 2G8)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
MARK3 mouse monoclonal antibody, clone OTI2D3 (formerly 2D3)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
MARK3 mouse monoclonal antibody, clone OTI2D3 (formerly 2D3), Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
MARK3 mouse monoclonal antibody, clone OTI2D3 (formerly 2D3), HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
MARK3 mouse monoclonal antibody, clone OTI2D3 (formerly 2D3)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
MARK3 mouse monoclonal antibody, clone OTI2D9 (formerly 2D9)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
MARK3 mouse monoclonal antibody, clone OTI2D9 (formerly 2D9), Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
MARK3 mouse monoclonal antibody, clone OTI2D9 (formerly 2D9), HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
MARK3 mouse monoclonal antibody, clone OTI2D9 (formerly 2D9)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
MARK3 mouse monoclonal antibody, clone OTI3F6 (formerly 3F6)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
MARK3 mouse monoclonal antibody, clone OTI3F6 (formerly 3F6), Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
MARK3 mouse monoclonal antibody, clone OTI3F6 (formerly 3F6), HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
MARK3 mouse monoclonal antibody, clone OTI3F6 (formerly 3F6)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
MARK3 mouse monoclonal antibody, clone OTI3E11 (formerly 3E11)
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
MARK3 mouse monoclonal antibody, clone OTI3E11 (formerly 3E11), Biotinylated
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
MARK3 mouse monoclonal antibody, clone OTI3E11 (formerly 3E11), HRP conjugated
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
MARK3 mouse monoclonal antibody, clone OTI3E11 (formerly 3E11)
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
MARK3 mouse monoclonal antibody, clone OTI3D8 (formerly 3D8)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
MARK3 mouse monoclonal antibody, clone OTI3D8 (formerly 3D8), Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
MARK3 mouse monoclonal antibody, clone OTI3D8 (formerly 3D8), HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
MARK3 mouse monoclonal antibody, clone OTI3D8 (formerly 3D8)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
MARK3 mouse monoclonal antibody, clone OTI4A3 (formerly 4A3)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
MARK3 mouse monoclonal antibody, clone OTI4A3 (formerly 4A3), Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
MARK3 mouse monoclonal antibody, clone OTI4A3 (formerly 4A3), HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
MARK3 mouse monoclonal antibody, clone OTI4A3 (formerly 4A3)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
MARK3 mouse monoclonal antibody, clone OTI5E5 (formerly 5E5)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
MARK3 mouse monoclonal antibody, clone OTI5E5 (formerly 5E5), Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
MARK3 mouse monoclonal antibody, clone OTI5E5 (formerly 5E5), HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
MARK3 mouse monoclonal antibody, clone OTI5E5 (formerly 5E5)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |