MATN2 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human MATN2 |
MATN2 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human MATN2 |
Rabbit Polyclonal Anti-MATN2 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MATN2 antibody: synthetic peptide directed towards the middle region of human MATN2. Synthetic peptide located within the following region: AVGVGKAIEEELQEIASEPTNKHLFYAEDFSTMDEISEKLKKGICEALED |
Rabbit Polyclonal MATN2 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | MATN2 antibody was raised against a 15 amino acid peptide from near the carboxy terminus of human MATN2. |
Rabbit polyclonal MATN2 Antibody (C-term)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This MATN2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 732-760 amino acids from the C-terminal region of human MATN2. |
MATN2 Antibody - C-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-MATN2 antibody is a synthetic peptide directed towards the C-terminal region of Human MATN2 |
MATN2 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 800 to the C-terminus of human MATN2 (NP_001304677.1). |
Modifications | Unmodified |