Antibodies

View as table Download

Rabbit polyclonal anti-MAZ antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human MAZ.

Rabbit Polyclonal Anti-MAZ Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-MAZ Antibody: synthetic peptide directed towards the N terminal of human MAZ. Synthetic peptide located within the following region: FPVFPCTLLAPPFPVLGLDSRGVGGLMNSFPPPQGHAQNPLQVGAELQSR

Rabbit Polyclonal Anti-MAZ Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MAZ antibody: synthetic peptide directed towards the N terminal of human MAZ. Synthetic peptide located within the following region: QGHAQNPLQVGAELQSRFFASQGCAQSPFQAAPAPPPTPQAPAAEPLQVD

Rabbit Polyclonal Anti-MAZ Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MAZ antibody: synthetic peptide directed towards the middle region of human MAZ. Synthetic peptide located within the following region: ALEKKTKSKGPYICALCAKEFKNGYNLRRHEAIHTGAKAGRVPSGAMKMP

MAZ Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 270-420 of human MAZ (NP_001036004.1).
Modifications Unmodified