Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-Mri1 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Mri1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: IVAKHHGVPFYVAAPSSSCDLHLESGKEIVIEERPSQELTDLNGVRIAAQ |
Rabbit Polyclonal Anti-Mri1 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Mri1 antibody: synthetic peptide directed towards the N terminal of mouse 2410018C20RIK. Synthetic peptide located within the following region: LGQVAAQEAEREGATEETVRERVIRFAEDMLEKDLKDNRSIGDLGARHLL |
Rabbit Polyclonal Anti-MRI1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MGC3207 antibody: synthetic peptide directed towards the N terminal of human MGC3207. Synthetic peptide located within the following region: VNMARAARDLADVAAREAEREGATEEAVRERRETELCEHWEEHTRQRELP |
Rabbit Polyclonal Anti-MRI1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MGC3207 antibody: synthetic peptide directed towards the N terminal of human MGC3207. Synthetic peptide located within the following region: ARDLADVAAREAEREGATEEAVRERRETELCEHWEEHTRQRELPLRGPLG |
MRI1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-369 of human MRI1 (NP_001026897.1). |
| Modifications | Unmodified |
USD 420.00
4 Weeks
Active filters
Target Symbol
- MRI1