Rabbit polyclonal anti-Musculin antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Musculin. |
Rabbit polyclonal anti-Musculin antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Musculin. |
Goat Anti-MSC / ABF1 Antibody
Applications | WB |
Reactivities | Expected from seq similarity: Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-PLKSDWNSLDGIIR, from the C Terminus of the protein sequence according to AAC15071.1. |
Rabbit Polyclonal Anti-Musculin Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Musculin Antibody: A synthesized peptide derived from human Musculin |
Rabbit Polyclonal Anti-Msc Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Msc antibody: synthetic peptide directed towards the C terminal of mouse Msc. Synthetic peptide located within the following region: IAHLRQLLQEDRYEDSYVHPVNLTWPFVVSGRPDSDSKDVSAANRLCGTS |