Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Mouse Monoclonal MUC 1 Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
EMA (MUC1) mouse monoclonal antibody, clone EMA-39, Purified
| Applications | IF, IHC, IP |
| Reactivities | Human |
Rabbit polyclonal CD227/MUC1 (Tyr1229) antibody(Phospho-specific)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human CD227/MUC1 around the phosphorylation site of tyrosine 1229 (S-P-YP-E-K) |
| Modifications | Phospho-specific |
Rabbit Polyclonal MUC-1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Equine, Guinea Pig, Porcine |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptides corresponding to MUC1(mucin 1, cell surface associated) The peptide sequence was selected from the C terminal region between aa 1200-1250 of human MUC1 (NP_001037855). Peptide sequence GQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSL. |
Rabbit Polyclonal Anti-Phospho-CD227/MUC1(Tyr1229) Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Phospho-CD227/MUC1(Tyr1229) Antibody: A synthesized peptide derived from human CD227/MUC1 around the phosphorylation site of Tyrosine 1229 |
| Modifications | Phospho-specific |
EMA (MUC1) rabbit polyclonal antibody, Aff - Purified
| Applications | IF, IHC |
| Reactivities | Human, Mouse |
EMA (MUC1) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | Synthetic peptide - KLH conjugated - corresponding to human CD227 / Mucin-1 / MUC1 (between 1202-1231aa) |
Rabbit polyclonal anti-PGRMC2 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human PGRMC2. |
Rabbit Polyclonal MUC1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | MUC1 antibody was raised against a 17 amino acid peptide near the carboxy terminus of human MUC1. The immunogen is located within the last 50 amino acids of MUC1 . |
Mouse monoclonal Anti-MUC1 Clone C-Mu1
| Reactivities | Human |
| Conjugation | Unconjugated |
Mouse monoclonal Anti-MUC1 Clone SM3
| Reactivities | Human |
| Conjugation | Unconjugated |
Mouse monoclonal Anti-MUC1 Clone HMFG1
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MUC1 mouse monoclonal antibody,clone OTIA3E2
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Mouse Monoclonal EMA Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-MUC1(NT) Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human MUC1(NT) |
Epithelial Membrane Antigen Mouse Monoclonal Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
MUC1 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1182-1255aa of human MUC1 (NP_002708.1). |
| Modifications | Unmodified |
Recombinant Anti-MUC1 (Clone SM3)
| Applications | ELISA, FC, IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Recombinant Anti-MUC1 (Clone SM3)
| Applications | ELISA, FC, IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Modifications | This chimeric rabbit antibody was made using the variable domain sequences of the original murine IgG1 format, for improved compatibility with existing reagents, assays and techniques. |
Recombinant Anti-MUC1 (Clone Mc5)
| Applications | ELISA, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Recombinant Anti-MUC1 (Clone Mc5)
| Applications | ELISA, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Modifications | This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG2 format, for improved compatibility with existing reagents, assays and techniques. |
Recombinant Anti-MUC1 (Clone HMFG2)
| Applications | ELISA, IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Recombinant Anti-MUC1 (Clone HMFG2)
| Applications | ELISA, IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Modifications | This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG1 format, for improved compatibility with existing reagents, assays and techniques. |
Recombinant Anti-MUC1 (Clone HMFG1 (1.10.F3))
| Applications | ELISA, IF, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Recombinant Anti-MUC1 (Clone HMFG1 (1.10.F3))
| Applications | ELISA, IF, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Modifications | This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG1 format, for improved compatibility with existing reagents, assays and techniques. |
Recombinant Anti-MUC1 (Clone PAM4)
| Applications | ELISA, FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Recombinant Anti-MUC1 (Clone PAM4)
| Applications | ELISA, FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Modifications | This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG1 format, for improved compatibility with existing reagents, assays and techniques. |
USD 399.00
In Stock
USD 399.00
In Stock
MUC1 mouse monoclonal antibody,clone OTIA3E2
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
5 Days
MUC1 mouse monoclonal antibody,clone A3E2, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
USD 420.00
5 Days
MUC1 mouse monoclonal antibody,clone A3E2, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
MUC1 mouse monoclonal antibody,clone OTIA3E2
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- MUC1
Filter by
Category
Reactivities
Applications
Antibody Hosts
Isotypes
Clonalities
Conjugates
Modifications
- This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG1 format, for improved compatibility with existing reagents, assays and techniques. (3)
- Phospho-specific (2)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG2 format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original murine IgG1 format, for improved compatibility with existing reagents, assays and techniques. (1)
- Unmodified (1)