Antibodies

View as table Download

Rabbit Polyclonal NCLN Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen NCLN antibody was raised against an 18 amino acid synthetic peptide near the carboxy terminus of human NCLN.

Rabbit Polyclonal Anti-NCLN Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-NCLN antibody is: synthetic peptide directed towards the C-terminal region of Human NCLN. Synthetic peptide located within the following region: DKDSTFLSTLEHHLSRYLKDVKQHHVKADKRDPEFVFYDQLKQVMNAYRV

NCLN Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N-terminal region of Human NCLN

NCLN rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human NCLN

NCLN rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human NCLN