Rabbit Polyclonal NCLN Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | NCLN antibody was raised against an 18 amino acid synthetic peptide near the carboxy terminus of human NCLN. |
Rabbit Polyclonal NCLN Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | NCLN antibody was raised against an 18 amino acid synthetic peptide near the carboxy terminus of human NCLN. |
Rabbit Polyclonal Anti-NCLN Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-NCLN antibody is: synthetic peptide directed towards the C-terminal region of Human NCLN. Synthetic peptide located within the following region: DKDSTFLSTLEHHLSRYLKDVKQHHVKADKRDPEFVFYDQLKQVMNAYRV |
NCLN Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human NCLN |
NCLN rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human NCLN |
NCLN rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human NCLN |