Mimitin (NDUFAF2) (C-term) rabbit polyclonal antibody, Purified
Applications | ELISA, IF, IHC, WB |
Reactivities | Human |
Immunogen | Synthetic peptide - KLH conjugated |
Mimitin (NDUFAF2) (C-term) rabbit polyclonal antibody, Purified
Applications | ELISA, IF, IHC, WB |
Reactivities | Human |
Immunogen | Synthetic peptide - KLH conjugated |
Rabbit Polyclonal Mimitin Antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Mimitin antibody was raised against a 14 amino acid peptide from near the carboxy terminus of human Mimitin. |
Rabbit Polyclonal Anti-NDUFAF2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NDUFAF2 antibody is: synthetic peptide directed towards the N-terminal region of Human NDUFAF2. Synthetic peptide located within the following region: HVGTDQFGNKYYYIPQYKNWRGQTIREKRIVEAANKKEVDYEAGDIPTEW |
Rabbit Polyclonal Anti-NDUFAF2 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human NDUFAF2 |
NDUFAF2 Rabbit polyclonal Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-169 of human NDUFAF2 (NP_777549.1). |
Modifications | Unmodified |