Antibodies

View as table Download

Mimitin (NDUFAF2) (C-term) rabbit polyclonal antibody, Purified

Applications ELISA, IF, IHC, WB
Reactivities Human
Immunogen Synthetic peptide - KLH conjugated

Rabbit Polyclonal Mimitin Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Mimitin antibody was raised against a 14 amino acid peptide from near the carboxy terminus of human Mimitin.

Rabbit Polyclonal Anti-NDUFAF2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NDUFAF2 antibody is: synthetic peptide directed towards the N-terminal region of Human NDUFAF2. Synthetic peptide located within the following region: HVGTDQFGNKYYYIPQYKNWRGQTIREKRIVEAANKKEVDYEAGDIPTEW

Rabbit Polyclonal Anti-NDUFAF2 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human NDUFAF2

NDUFAF2 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-169 of human NDUFAF2 (NP_777549.1).
Modifications Unmodified