Rabbit Polyclonal Anti-NEK6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NEK6 antibody: synthetic peptide directed towards the N terminal of human NEK6. Synthetic peptide located within the following region: FRCSLADFQIEKKIGRGQFSEVYKATCLLDRKTVALKKVQIFEMMDAKAR |
Rabbit Polyclonal Anti-NEK6 Antibody (N-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | NEK6 antibody was raised against synthetic 14 amino acid peptide from N-terminus of human NEK6. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset (100%); Mouse, Rat, Hamster, Panda, Dog, Horse, Pig (86%). |
NEK6 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 35-347 of human NEK6 (NP_001159643.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
