NKAIN1 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, WB |
Reactivities | Human |
Immunogen | Synthetic peptide - KLH conjugated - corresponding to the C-terminal region (between 156-186aa) of human NKAIN1 / FAM77C |
NKAIN1 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, WB |
Reactivities | Human |
Immunogen | Synthetic peptide - KLH conjugated - corresponding to the C-terminal region (between 156-186aa) of human NKAIN1 / FAM77C |
Rabbit Polyclonal Anti-NKAIN1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NKAIN1 antibody: synthetic peptide directed towards the middle region of human NKAIN1. Synthetic peptide located within the following region: TPVLNSRLALEDHHVISVTGCLLDYPYIEALSSALQIFLALFGFVFACYV |