Antibodies

View as table Download

NKAIN1 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, WB
Reactivities Human
Immunogen Synthetic peptide - KLH conjugated - corresponding to the C-terminal region (between 156-186aa) of human NKAIN1 / FAM77C

Rabbit Polyclonal Anti-NKAIN1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NKAIN1 antibody: synthetic peptide directed towards the middle region of human NKAIN1. Synthetic peptide located within the following region: TPVLNSRLALEDHHVISVTGCLLDYPYIEALSSALQIFLALFGFVFACYV