Antibodies

Jump to Filters
View as table Download
NPM2 Rabbit Polyclonal Antibody
TA344382

USD 475.00

5 Days

Rabbit Polyclonal Anti-NPM2 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NPM2 antibody: synthetic peptide directed towards the N terminal of human NPM2. Synthetic peptide located within the following region: LEGKQSCRLLLHTICLGEKAKEEMHRVEILPPANQEDKKMQPVTIASLQA
NPM2 Rabbit Polyclonal Antibody
TA357434

USD 360.00

5 Days

NPM2 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N-terminal region of Human NPM2