Rabbit Polyclonal Anti-Nus1 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Nus1 Antibody is: synthetic peptide directed towards the middle region of Mouse Nus1. Synthetic peptide located within the following region: RLMDEILKQQQELLGQDCSKYSAEFANSNDKDDQDLNCPSAVKVLSPEDG |
Rabbit Polyclonal Nogo B receptor Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to amino acids 64-74 (RNRRHHRHPRG) of human Nogo-B receptor (NgBR) was used as immunogen, GenBank no sp|Q96E22.1|NGBR_HUMAN (Miao et al, 2006). This immunogen sequence is within the 93 amino acid putative ectodomain of th |
Carrier-free (BSA/glycerol-free) NUS1 mouse monoclonal antibody, clone OTI6C11 (formerly 6C11)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
NUS1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human NUS1 |
NUS1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human NUS1 |
NUS1 mouse monoclonal antibody, clone OTI6C11 (formerly 6C11)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
NUS1 mouse monoclonal antibody, clone OTI6C11 (formerly 6C11), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
USD 420.00
4 Weeks
NUS1 mouse monoclonal antibody, clone OTI6C11 (formerly 6C11), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
NUS1 mouse monoclonal antibody, clone OTI6C11 (formerly 6C11)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China