Rabbit Polyclonal Anti-NXF3 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NXF3 antibody: synthetic peptide directed towards the C terminal of human NXF3. Synthetic peptide located within the following region: SSFLVDMWYQTEWMLCFSVNGVFKEVEGQSQGSVLAFTRTFIATPGSSSS |
Rabbit Polyclonal Anti-NXF3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NXF3 antibody: synthetic peptide directed towards the N terminal of human NXF3. Synthetic peptide located within the following region: SLPSGHTTGHTDQVVQRRARCWDIYQRRFSSRSEPVNPGMHSSSHQQQDG |
Rabbit polyclonal anti-NXF3 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human NXF3. |
Germany
Japan
United Kingdom
China
