Antibodies

View as table Download

Rabbit Polyclonal Anti-NAGS Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NAGS antibody: synthetic peptide directed towards the C terminal of human NAGS. Synthetic peptide located within the following region: YLDKFVVSSSRQGQGSGQMLWECLRRDLQTLFWRSRVTNPINPWYFKHSD

NAGS Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 295-534 of human NAGS (NP_694551.1).
Modifications Unmodified