Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-NDN Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NDN antibody: synthetic peptide directed towards the middle region of human NDN. Synthetic peptide located within the following region: VALSNRMPMTGLLLMILSLIYVKGRGARESAVWNVLRILGLRPWKKHSTF |
Carrier-free (BSA/glycerol-free) NDN mouse monoclonal antibody, clone OTI3A12 (formerly 3A12)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NDN mouse monoclonal antibody, clone OTI5D1 (formerly 5D1)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NDN mouse monoclonal antibody, clone OTI1B1 (formerly 1B1)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
NDN Antibody - C-terminal region
| Applications | WB |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of mouse NDN |
NDN mouse monoclonal antibody, clone OTI3A12 (formerly 3A12)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
NDN mouse monoclonal antibody, clone OTI3A12 (formerly 3A12)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
NDN mouse monoclonal antibody, clone OTI1B1 (formerly 1B1)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
NDN mouse monoclonal antibody, clone OTI1B1 (formerly 1B1)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- NDN