Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-NFE2L3 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human NFE2L3. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-NFE2L3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NFE2L3 antibody: synthetic peptide directed towards the middle region of human NFE2L3. Synthetic peptide located within the following region: NPEQTLPGTNLTGFLSPVDNHMRNLTSQDLLYDLDINIFDEINLMSLATE |
NFE2L3 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 300-550 of human NFE2L3 (NP_004280.5). |
| Modifications | Unmodified |
Active filters
Target Symbol
- NFE2L3