Antibodies

View as table Download

Rabbit Polyclonal NPFFR2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen N terminal sequence MNEKWDTNSSENWHPI and the C terminal sequence ELVMEELKETTNSSEI of the human NPFF2 protein.

Rabbit Polyclonal Anti-NPFFR2 Antibody (C-Terminus)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen NPFF2 / NPFFR2 antibody was raised against synthetic 18 amino acid peptide from C-terminus of human NPFFR2. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Gibbon, Monkey (94%); Marmoset (89%).

Rabbit Polyclonal Anti-NPFFR2 Antibody (Extracellular Domain)

Applications IHC
Reactivities Human
Immunogen NPFF2 / NPFFR2 antibody was raised against synthetic 18 amino acid peptide from 3rd extracellular domain of human NPFFR2. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Marmoset, Horse (100%); Monkey, Elephant, Rabbit, Pig (94%); Dog, Bovine (89%); Mouse, Rat, Panda, Bat (83%).

Rabbit Polyclonal Anti-NPFFR2 Antibody (N-Terminus)

Applications IHC
Reactivities Human
Immunogen NPFF2 / NPFFR2 antibody was raised against synthetic 20 amino acid peptide from N-terminal extracellular domain of human NPFFR2. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Gibbon (95%).

Rabbit Polyclonal Anti-NPFFR2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NPFFR2 antibody: synthetic peptide directed towards the C terminal of human NPFFR2. Synthetic peptide located within the following region: KAKSHVLINTSNQLVQESTFQNPHGETLLYRKSAEKPQQELVMEELKETT

Rabbit Polyclonal Anti-NPFFR2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NPFFR2 antibody: synthetic peptide directed towards the middle region of human NPFFR2. Synthetic peptide located within the following region: VPHTGRKNQEQWHVVSRKKQKIIKMLLIVALLFILSWLPLWTLMMLSDYA

NPFFR2 Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human NPFFR2 (NP_004876.2).
Modifications Unmodified