Rabbit Polyclonal TrkC Antibody
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to the extracellular domain of the human TrkC protein (within residues 300-400). [UniProt Q16288]. |
Rabbit Polyclonal TrkC Antibody
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to the extracellular domain of the human TrkC protein (within residues 300-400). [UniProt Q16288]. |
Rabbit anti-NTRK3 Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human NTRK3 |
Rabbit polyclonal Anti-TrkC (extracellular)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide (C)GHFLKEPFPESTD, corresponding to amino acid residues 393-405 of rat TrkC . Extracellular, N-terminus. |
Rabbit polyclonal anti-TrkCT1 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids near the carboxyl terminus of mouse TrkCT1 protein. |
Rabbit polyclonal TrkC Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This TrkC antibody is generated from rabbits immunized with a his tag recombinant protein of human TrkC. |
Rabbit Polyclonal Anti-NTRK3
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NTRK3 antibody: synthetic peptide directed towards the C terminal of human NTRK3. Synthetic peptide located within the following region: ERPRVCPKEVYDVMLGCWQREPQQRLNIKEIYKILHALGKATPIYLDILG |
Carrier-free (BSA/glycerol-free) NTRK3 mouse monoclonal antibody, clone OTI24B3 (formerly 24B3)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NTRK3 mouse monoclonal antibody, clone OTI2B8 (formerly 2B8)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NTRK3 mouse monoclonal antibody, clone OTI4E10 (formerly 4E10)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NTRK3 mouse monoclonal antibody, clone OTI19B8 (formerly 19B8)
Applications | WB |
Reactivities | Human, Mouse, Rat, Dog |
Conjugation | Unconjugated |
NTRK3 Rabbit polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 40-300 of human NTRK3 (NP_001007157.1). |
Modifications | Unmodified |
Anti-NTRK3 (TrkC) mouse monoclonal antibody, clone OTI24B3 (formerly 24B3)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: “NEURO15".
USD 420.00
4 Weeks
Anti-NTRK3 (TrkC) mouse monoclonal antibody, clone OTI24B3 (formerly 24B3), Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
Anti-NTRK3 (TrkC) mouse monoclonal antibody, clone OTI24B3 (formerly 24B3), HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
Anti-NTRK3 (TrkC) mouse monoclonal antibody, clone OTI24B3 (formerly 24B3)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Anti-NTRK3 (TrkC) mouse monoclonal antibody, clone OTI2B8 (formerly 2B8)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: “NEURO15".
USD 420.00
4 Weeks
Anti-NTRK3 (TrkC) mouse monoclonal antibody, clone OTI2B8 (formerly 2B8), Biotinylated
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
Anti-NTRK3 (TrkC) mouse monoclonal antibody, clone OTI2B8 (formerly 2B8), HRP conjugated
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
Anti-NTRK3 (TrkC) mouse monoclonal antibody, clone OTI2B8 (formerly 2B8)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Anti-NTRK3 (TrkC) mouse monoclonal antibody, clone OTI4E10 (formerly 4E10)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: “NEURO15".
USD 420.00
4 Weeks
Anti-NTRK3 (TrkC) mouse monoclonal antibody, clone OTI4E10 (formerly 4E10), Biotinylated
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
Anti-NTRK3 (TrkC) mouse monoclonal antibody, clone OTI4E10 (formerly 4E10), HRP conjugated
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
Anti-NTRK3 (TrkC) mouse monoclonal antibody, clone OTI4E10 (formerly 4E10)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Anti-NTRK3 (TrkC) mouse monoclonal antibody, clone OTI19B8 (formerly 19B8)
Applications | WB |
Reactivities | Human, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: “NEURO15".
USD 420.00
5 Days
NTRK3 mouse monoclonal antibody, clone 19B8, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat, Dog |
Conjugation | Biotin |
USD 420.00
5 Days
NTRK3 mouse monoclonal antibody, clone 19B8, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat, Dog |
Conjugation | HRP |
Anti-NTRK3 (TrkC) mouse monoclonal antibody, clone OTI19B8 (formerly 19B8)
Applications | WB |
Reactivities | Human, Mouse, Rat, Dog |
Conjugation | Unconjugated |