Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal NUDT5 Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit Polyclonal Anti-NUDT5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NUDT5 antibody is: synthetic peptide directed towards the N-terminal region of Human NUDT5. Synthetic peptide located within the following region: EKTTYMDPTGKTRTWESVKRTTRKEQTADGVAVIPVLQRTLHYECIVLVK |
NUDT5 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-219 of human NUDT5 (NP_054861.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- NUDT5