OR10A4 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 248-277 amino acids from the C-terminal region of Human Olfactory receptor 10A4 |
OR10A4 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 248-277 amino acids from the C-terminal region of Human Olfactory receptor 10A4 |
Rabbit Polyclonal Anti-OR10A4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-OR10A4 Antibody is: synthetic peptide directed towards the C-terminal region of Human OR10A4. Synthetic peptide located within the following region: TAILTYFRPQSSASSESKKLLSLSSTVVTPMLNPIIYSSRNKEVKAALKR |