Antibodies

Jump to Filters
View as table Download
OR1C1 Rabbit Polyclonal Antibody
TA342694

USD 375.00

5 Days

Rabbit Polyclonal Anti-OR1C1 Antibody

Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-OR1C1 antibody: synthetic peptide directed towards the C terminal of human OR1C1. Synthetic peptide located within the following region: AVGGLLALTPLVCILVSYGLIFSTVLKITSTQGKQRAVSTCSCHLSVVVL
OR1C1 Rabbit Polyclonal Antibody
TA357615

USD 360.00

5 Days

OR1C1 Antibody - C-terminal region

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of mouse OR1C1