Rabbit polyclonal anti-OR1D2 antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human OR1D2. |
Rabbit polyclonal anti-OR1D2 antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human OR1D2. |
OR1D2 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 285-312 amino acids from the C-terminal region of Human Olfactory receptor 1D2 |
Rabbit Polyclonal Anti-OR1D2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-OR1D2 antibody: synthetic peptide directed towards the C terminal of human OR1D2. Synthetic peptide located within the following region: LHTYSVKDSVATVMYAVVTPMMNPFIYSLRNKDMHGALGRLLDKHFKRLT |