Antibodies

Jump to Filters
View as table Download
OR2L2 Rabbit Polyclonal Antibody
TA337491

USD 375.00

5 Days

Rabbit Polyclonal Anti-OR2L2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-OR2L2 antibody is: synthetic peptide directed towards the C-terminal region of Human OR2L2. Synthetic peptide located within the following region: HLTVVSFYYAPFAYTYVRPRSLRSPTEDKILAVFYTILTPMLNPIIYSLR