Antibodies

Jump to Filters
View as table Download
OR4N5 Rabbit Polyclonal Antibody
TA337514

USD 375.00

5 Days

Rabbit Polyclonal Anti-OR4N5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-OR4N5 antibody is: synthetic peptide directed towards the C-terminal region of Human OR4N5. Synthetic peptide located within the following region: AIFIYTCPFQAFPADKVVSLFHTVIFPLMNPVIYTLRNQEVKASMRKLLS