Rabbit polyclonal anti-OR51B6 antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human OR51B6. |
Rabbit polyclonal anti-OR51B6 antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human OR51B6. |
Rabbit Polyclonal Anti-OR51B6 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-OR51B6 antibody is: synthetic peptide directed towards the C-terminal region of Human OR51B6. Synthetic peptide located within the following region: VLFAMVLLDFLIIFFSYILILKTVMGIGSGGERAKALNTCVSHICCILVF |