Antibodies

View as table Download

Rabbit Polyclonal Anti-OTP Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-OTP antibody: synthetic peptide directed towards the N terminal of human OTP. Synthetic peptide located within the following region: MLSHADLLDARLGMKDAAELLGHREAVKCRLGVGGSDPGGHPGDLAPNSD

Rabbit Polyclonal Anti-OTP Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-OTP antibody: synthetic peptide directed towards the C terminal of human OTP. Synthetic peptide located within the following region: PAFPGMVPASLPGPSNVSGSPQLCSSPDSSDVWRGTSIASLRRKALEHTV

Rabbit Polyclonal Anti-OTP Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-OTP antibody: synthetic peptide directed towards the N terminal of human OTP. Synthetic peptide located within the following region: SDPGGHPGDLAPNSDPVEGATLLPGEDITTVGSTPASLAVSAKDPDKQPG

OTP Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-130 of human OTP (NP_115485.1).
Modifications Unmodified