Germany
Japan
United Kingdom
China
P2RY6 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human P2RY6 |
Antibodies
View as table Download
Rabbit polyclonal Anti-P2Y6 Receptor
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide CQPHDLLQKLTAKWQRQRV, corresponding to amino acid residues 311-328 of rat P2Y6 receptor. Intracellular, C-terminus. |
Rabbit Polyclonal Anti-P2RY6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-P2RY6 antibody is: synthetic peptide directed towards the N-terminal region of Human P2RY6. Synthetic peptide located within the following region: NLHGSILFLTCISFQRYLGICHPLAPWHKRGGRRAAWLVCVAVWLAVTTQ |
Active filters
Target Symbol
- P2RY6