Rabbit Polyclonal Anti-PAPLN Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PAPLN antibody is: synthetic peptide directed towards the C-terminal region of Human PAPLN. Synthetic peptide located within the following region: YQGSQAVSRSTEVKVVSPAPTAQPRDPGRDCVDQPELANCDLILQAQLCG |
Rabbit Polyclonal Anti-PAPLN Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PAPLN antibody is: synthetic peptide directed towards the C-terminal region of Human PAPLN. Synthetic peptide located within the following region: QPISSDRHRLQFDGSLIIHPLQAEDAGTYSCGSTRPGRDSQKIQLRIIGG |
Germany
Japan
United Kingdom
China