PCDHB14 (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | Synthetic peptide - KLH conjugated - corresponding to the N-terminal region (between 165-193aa) of human PCDHB14. |
PCDHB14 (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | Synthetic peptide - KLH conjugated - corresponding to the N-terminal region (between 165-193aa) of human PCDHB14. |
Rabbit polyclonal Anti-PCDHB14 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-PCDHB14 antibody is: synthetic peptide directed towards the middle region of Human PCDHB14. Synthetic peptide located within the following region: YGKISYTFFHASEDIRKTFEINPISGEVNLRSPLDFEVIQSYTINIQATD |