Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal Anti-PCDHGB5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PCDHGB5 antibody is: synthetic peptide directed towards the middle region of Human PCDHGB5. Synthetic peptide located within the following region: LIALIKIHDQDSGENGEVNCQLQGEVPFKIISSSKNSYKLVTDGTLDREQ |
Rabbit polyclonal Anti-PCDHGB5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PCDHGB5 antibody is: synthetic peptide directed towards the middle region of Human PCDHGB5. Synthetic peptide located within the following region: PLSGTTELRIQVTDANDNPPVFNRDVYRVSLRENVPPGTTVLQVSATDQD |
PCDHGB5 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human PCDHGB5 |
Active filters
Target Symbol
- PCDHGB5