Germany
Japan
United Kingdom
China
Rabbit anti-PDZK1 Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PDZK1 |
Antibodies
View as table Download
Rabbit Polyclonal Anti-PDZK1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PDZK1 antibody: synthetic peptide directed towards the n terminal of human PDZK1. Synthetic peptide located within the following region: MTSTFNPRECKLSKQEGQNYGFFLRIEKDTEGHLVRVVEKCSPAEKAGLQ |
Rabbit Polyclonal Anti-PDZK1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PDZK1 antibody: synthetic peptide directed towards the N terminal of human PDZK1. Synthetic peptide located within the following region: NSVTLLVLDGDSYEKAVKTRVDLKELGQSQKEQGLSDNILSPVMNGGVQT |
PDZK1 mouse monoclonal antibody, clone AT1A2, Purified
| Applications | ELISA, WB |
| Reactivities | Human |
PDZK1 mouse monoclonal antibody, clone AT1A2, Purified
| Applications | ELISA, WB |
| Reactivities | Human |
Carrier-free (BSA/glycerol-free) PDZK1 mouse monoclonal antibody,clone OTI2B2
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
PDZK1 Antibody - middle region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of mouse PDZK1 |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
PDZK1 mouse monoclonal antibody,clone OTI2B2
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
PDZK1 mouse monoclonal antibody,clone OTI2B2, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
PDZK1 mouse monoclonal antibody,clone OTI2B2, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
PDZK1 mouse monoclonal antibody,clone OTI2B2
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- PDZK1