Rabbit Polyclonal Anti-PHYHIP Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PHYHIP antibody: synthetic peptide directed towards the N terminal of human PHYHIP. Synthetic peptide located within the following region: KFKHRDVPTKLVAKAVPLPMTVRGHWFLSPRTEYSVAVQTAVKQSDGEYL |
Rabbit Polyclonal Anti-PHYHIP Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PHYHIP antibody: synthetic peptide directed towards the N terminal of human PHYHIP. Synthetic peptide located within the following region: VSGWSETVEFCTGDYAKEHLAQLQEKAEQIAGRMLRFSVFYRNHHKEYFQ |
Germany
Japan
United Kingdom
China