Rabbit Polyclonal Anti-PI4K2B Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PI4K2B antibody: synthetic peptide directed towards the middle region of human PI4K2B. Synthetic peptide located within the following region: IIGVFKPKSEEPYGQLNPKWTKYVHKVCCPCCFGRGCLIPNQGYLSEAGA |
Rabbit Polyclonal Anti-PI4K2B Antibody - N-terminal region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Pi4k2b antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: EDPEFADIVLKAEQAIEIGVFPERISQGSSGSYFVKDSKRNIIGVFKPKS |
PI4K2B Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human PI4K2B (NP_060793.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China