Rabbit Polyclonal Anti-PKNOX2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PKNOX2 antibody: synthetic peptide directed towards the middle region of human PKNOX2. Synthetic peptide located within the following region: TSQGQVVTQAIPQGAIQIQNTQVNLDLTSLLDNEDKKSKNKRGVLPKHAT |
Rabbit Polyclonal Anti-PKNOX2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PKNOX2 Antibody: A synthesized peptide derived from human PKNOX2 |
Rabbit polyclonal anti-PKNOX2 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human PKNOX2. |
Rabbit Polyclonal Anti-PKNOX2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PKNOX2 Antibody: synthetic peptide directed towards the N terminal of human PKNOX2. Synthetic peptide located within the following region: ATQNVPPPPYQDSPQMTATAQPPSKAQAVHISAPSAAASTPVPSAPIDPQ |
PKNOX2 Rabbit polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthesized peptide derived from the C-terminal region of human PREP-2. at AA rangle: 310-390 |
Germany
Japan
United Kingdom
China