Rabbit Polyclonal PRICKLE2 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | PRICKLE2 antibody was raised against a 15 amino acid synthetic peptide near the center of human PRICKLE2. |
Rabbit Polyclonal PRICKLE2 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | PRICKLE2 antibody was raised against a 15 amino acid synthetic peptide near the center of human PRICKLE2. |
Rabbit Polyclonal Anti-PRICKLE2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PRICKLE2 antibody is: synthetic peptide directed towards the C-terminal region of Human PRICKLE2. Synthetic peptide located within the following region: IPQPARLRYVTSDELLHKYSSYGLPKSSTLGGRGQLHSRKRQKSKNCIIS |
PRICKLE2 Rabbit polyclonal Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 615-844 of human PRICKLE2 (NP_942559.1). |
Modifications | Unmodified |