Antibodies

View as table Download

Rabbit Polyclonal PRICKLE2 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen PRICKLE2 antibody was raised against a 15 amino acid synthetic peptide near the center of human PRICKLE2.

Rabbit Polyclonal Anti-PRICKLE2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PRICKLE2 antibody is: synthetic peptide directed towards the C-terminal region of Human PRICKLE2. Synthetic peptide located within the following region: IPQPARLRYVTSDELLHKYSSYGLPKSSTLGGRGQLHSRKRQKSKNCIIS

PRICKLE2 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 615-844 of human PRICKLE2 (NP_942559.1).
Modifications Unmodified