Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-PTER Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PTER antibody: synthetic peptide directed towards the N terminal of human PTER. Synthetic peptide located within the following region: NAYSHKENLQLNQETEAIKEELLYFKANGGGALVENTTTGISRDTQTLKR |
Carrier-free (BSA/glycerol-free) PTER mouse monoclonal antibody,clone OTI1G4
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PTER mouse monoclonal antibody,clone OTI2F9
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
PTER Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human PTER |
PTER mouse monoclonal antibody,clone OTI1G4
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
PTER mouse monoclonal antibody,clone OTI1G4, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
PTER mouse monoclonal antibody,clone OTI1G4, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
PTER mouse monoclonal antibody,clone OTI1G4
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
PTER mouse monoclonal antibody,clone OTI2F9
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
PTER mouse monoclonal antibody,clone OTI2F9, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
PTER mouse monoclonal antibody,clone OTI2F9, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
PTER mouse monoclonal antibody,clone OTI2F9
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- PTER