Germany
Japan
United Kingdom
China
Antibodies
View as table Download
PAX4 (Center) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide selected from the ?-terminal region of human PAX4 Antibody (Center). |
Rabbit Polyclonal Anti-PAX4 Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Immunogen | The immunogen for anti-PAX4 antibody: synthetic peptide directed towards the middle region of human PAX4. Synthetic peptide located within the following region: RTIFSPSQAEALEKEFQRGQYPDSVARGKLATATSLPEDTVRVWFSNRRA |
Rabbit Polyclonal Anti-PAX4 Antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | The immunogen for anti-PAX4 antibody: synthetic peptide directed towards the N terminal of human PAX4. Synthetic peptide located within the following region: ISRILKVSNGCVSKILGRYYRTGVLEPKGIGGSKPRLATPPVVARIAQLK |
Carrier-free (BSA/glycerol-free) PAX4 mouse monoclonal antibody,clone OTI2F3
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PAX4 mouse monoclonal antibody, clone OTI3H1 (formerly 3H1)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PAX4 mouse monoclonal antibody,clone OTI6H4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
PAX4 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 50-200 of human PAX4 (NP_006184.2). |
| Modifications | Unmodified |
PAX4 mouse monoclonal antibody,clone OTI2F3
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
PAX4 mouse monoclonal antibody,clone 2F3, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
PAX4 mouse monoclonal antibody,clone 2F3, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
PAX4 mouse monoclonal antibody,clone OTI2F3
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
PAX4 mouse monoclonal antibody, clone OTI3H1 (formerly 3H1)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
PAX4 mouse monoclonal antibody,clone 3H1, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
PAX4 mouse monoclonal antibody,clone 3H1, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
PAX4 mouse monoclonal antibody, clone OTI3H1 (formerly 3H1)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
PAX4 mouse monoclonal antibody,clone OTI6H4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
PAX4 mouse monoclonal antibody,clone 6H4, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
PAX4 mouse monoclonal antibody,clone 6H4, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
PAX4 mouse monoclonal antibody,clone OTI6H4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- PAX4